Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberQ9UGJ1
OrganismHomo sapiens (Human)
Protein namesGamma-tubulin complex component 4
Gene namesTUBGCP4
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Accession NumberDescription
0000086 G2/M transition of mitotic cell cycle
0000278 mitotic cell cycle
0006461 protein complex assembly
0007020 microtubule nucleation
Cellular component
Accession numberDescription
0000922 spindle pole
0005813 centrosome
0005829 cytosol
0005874 microtubule
0008274 gamma-tubulin ring complex
0015630 microtubule cytoskeleton
Molecular function
AccessionGO Description
0005200 structural constituent of cytoskeleton
Ubiquitination annotation(Features)
Ubiquitination siteK358; K233; K315;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1233/667IGGLTGKQLRELQ Experimental21906983
No.2315/667AELHRLKQQPLFS Experimental21906983
No.3358/667GQLKIIKDFYLLG Experimental21890473
Protein squence
Length667
Sequence
MIHELLLALSGYPGSIFTWNKRSGLQVSQDFPFLHPSETSVLNRLCRLGTDYIRFTEFIE
QYTGHVQQQDHHPSQQGQGGLHGIYLRAFCTGLDSVLQPYRQALLDLEQEFLGDPHLSIS
HVNYFLDQFQLLFPSVMVVVEQIKSQKIHGCQILETVYKHSCGGLPPVRSALEKILAVCH
GVMYKQLSAWMLHGLLLDQHEEFFIKQGPSSGNVSAQPEEDEEDLGIGGLTGKQLRELQD
LRLIEEENMLAPSLKQFSLRVEILPSYIPVRVAEKILFVGESVQMFENQNVNLTRKGSIL
KNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDF
YLLGRGELFQAFIDTAQHMLKTPPTAVTEHDVNVAFQQSAHKVLLDDDNLLPLLHLTIEY
HGKEHKADATQAREGPSRETSPREAPASGWAALGLSYKVQWPLHILFTPAVLEKYNVVFK
YLLSVRRVQAELQHCWALQMQRKHLKSNQTDAIKWRLRNHMAFLVDNLQYYLQVDVLESQ
FSQLLHQINSTRDFESIRLAHDHFLSNLLAQSFILLKPVFHCLNEILDLCHSFCSLVSQN
LGPLDERGAAQLSILVKGFSRQSSLLFKILSSVRNHQINSDLAQLLLRLDYNKYYTQAGG
TLGSFGM
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21890473
    Wagner SA, Beli P, Weinert BT, Nielsen ML, Cox J, Mann M, Choudhary C. A proteome-wide, quantitative survey of in vivo ubiquitylation sites reveals widespread regulatory roles. Mol Cell Proteomics,2011,10(10):M111.013284.
  2. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn