Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberQ5T8U3
OrganismHomo sapiens (Human)
Protein namesRibosomal protein L7a
Gene namesRPL7A
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Cellular component
Molecular function
Ubiquitination annotation(Features)
Ubiquitination siteK102; K152; K64; K158; K53; K177; K124; K47; K61; K75;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.147/191PAPAVVKKQEAKK Experimental21906983
No.253/191KKQEAKKVVNPLF Experimental21890473
No.361/191VNPLFEKRPKNFG Experimental21906983
21890473
No.464/191LFEKRPKNFGIGQ Experimental21906983
21890473
No.575/191GQDIQPKRDLTRF Experimental21906983
21890473
No.6102/191ILYKRLKVPPAIN Experimental21906983
21890473
No.7124/191TATQLLKLAHKYR Experimental21890473
No.8152/191EKKAAGKGDVPTK Experimental21906983
No.9158/191KGDVPTKRPPVLR Experimental21906983
21890473
No.10177/191TTLVENKKAQLVV Experimental21906983
Protein squence
Length191
Sequence
MLVRLNVRCSCRGVVLGGCRKLLASLVQPKGKKAKGKKVAPAPAVVKKQEAKKVVNPLFE
KRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLKVPPAINQFTQALDRQTAT
QLLKLAHKYRPETKQEKKQRLLARAEKKAAGKGDVPTKRPPVLRAGVNTVTTLVENKKAQ
LVVIAHDVDPI
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
  2. PubMed:   21890473
    Wagner SA, Beli P, Weinert BT, Nielsen ML, Cox J, Mann M, Choudhary C. A proteome-wide, quantitative survey of in vivo ubiquitylation sites reveals widespread regulatory roles. Mol Cell Proteomics,2011,10(10):M111.013284.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn