Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberQ5T8T8
OrganismHomo sapiens (Human)
Protein namesIsoform Surf5A of Mediator of RNA polymerase II transcription subunit 22
Gene namesMED22
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Accession NumberDescription
Cellular component
Accession numberDescription
0016592 mediator complex
Molecular function
AccessionGO Description
0001104 RNA polymerase II transcription cofactor activity
Ubiquitination annotation(Features)
Ubiquitination siteK11;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.111/140RALPQSKETLLQS Experimental21890473
Protein squence
Length140
Sequence
MAQQRALPQSKETLLQSYNKRLKDDIKSIMDNFTEIIKTAKIEDETQVSRATQGEQDNYE
MHVRAANIVRAGESLMKLVSDLKQFLILNDFPSVNEAIDQRNQQLRTLQEECDRKLITLR
DEISIDLYELEEEYYSSRYK
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21890473
    Wagner SA, Beli P, Weinert BT, Nielsen ML, Cox J, Mann M, Choudhary C. A proteome-wide, quantitative survey of in vivo ubiquitylation sites reveals widespread regulatory roles. Mol Cell Proteomics,2011,10(10):M111.013284.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn