Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberQ3C162
OrganismHomo sapiens (Human)
Protein namesMajor histocompatibility complex, class I, A
Gene namesHLA-A
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Cellular component
Molecular function
Ubiquitination annotation(Features)
Ubiquitination siteK292;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1292/299QHEGLPKPLTLRW Experimental21890473
Protein squence
Length299
Sequence
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWV
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21890473
    Wagner SA, Beli P, Weinert BT, Nielsen ML, Cox J, Mann M, Choudhary C. A proteome-wide, quantitative survey of in vivo ubiquitylation sites reveals widespread regulatory roles. Mol Cell Proteomics,2011,10(10):M111.013284.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn