Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberQ07866-3
OrganismHomo sapiens (Human)
Protein namesIsoform G of Kinesin light chain 1
Gene namesKLC1
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Accession NumberDescription
0007018 microtubule-based movement
0007596 blood coagulation
0035617 stress granule disassembly
Cellular component
Accession numberDescription
0005829 cytosol
0005871 kinesin complex
0005874 microtubule
Molecular function
AccessionGO Description
0003774 motor activity
0003777 microtubule motor activity
0005515 protein binding
Ubiquitination annotation(Features)
Ubiquitination siteK518; K309;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1309/564LAVLYGKRGKYKE Experimental21890473
No.2518/564DPENMEKRRSRES Experimental21906983
Protein squence
Length564
Sequence
MYDNMSTMVYIKEDKLEKLTQDEIISKTKQVIQGLEALKNEHNSILQSLLETLKCLKKDD
ESNLVEEKSNMIRKSLEMLELGLSEAQVMMALSNHLNAVESEKQKLRAQVRRLCQENQWL
RDELANTQQKLQKSEQSVAQLEEEKKHLEFMNQLKKYDDDISPSEDKDTDSTKEPLDDLF
PNDEDDPGQGIQQQHSSAAAAAQQGGYEIPARLRTLHNLVIQYASQGRYEVAVPLCKQAL
EDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATL
NNLAVLYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKQLNNLALLCQNQGKYEEVEY
YYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVD
DENKPIWMHAEEREECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALYRRQGKF
EAAETLEEAAMRSRKQGLDNVHKQRVAEVLNDPENMEKRRSRESLNVDVVKYESGPDGGE
EGVSGRASFCGKRQQQQWPGRRHR
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
  2. PubMed:   21890473
    Wagner SA, Beli P, Weinert BT, Nielsen ML, Cox J, Mann M, Choudhary C. A proteome-wide, quantitative survey of in vivo ubiquitylation sites reveals widespread regulatory roles. Mol Cell Proteomics,2011,10(10):M111.013284.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn