Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberO15350-1
OrganismHomo sapiens (Human)
Protein namesIsoform Alpha of Tumor protein p73
Gene namesTP73
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Accession NumberDescription
0000122 negative regulation of transcription from RNA polymerase II promoter
0000187 activation of MAPK activity
0001822 kidney development
0001836 release of cytochrome c from mitochondria
0006298 mismatch repair
0006954 inflammatory response
0006974 response to DNA damage stimulus
0007050 cell cycle arrest
0009791 post-embryonic development
0010165 response to X-ray
0010243 response to organic nitrogen
0010332 response to gamma radiation
0021766 hippocampus development
0031571 mitotic cell cycle G1/S transition DNA damage checkpoint
0033326 cerebrospinal fluid secretion
0034644 cellular response to UV
0043508 negative regulation of JUN kinase activity
0043524 negative regulation of neuron apoptotic process
Cellular component
Accession numberDescription
0000785 chromatin
0005634 nucleus
0005667 transcription factor complex
0005829 cytosol
Molecular function
AccessionGO Description
0002039 p53 binding
0003682 chromatin binding
0003684 damaged DNA binding
0003690 double-stranded DNA binding
0003700 sequence-specific DNA binding transcription factor activity
0005515 protein binding
0008134 transcription factor binding
0019901 protein kinase binding
0043565 sequence-specific DNA binding
Ubiquitination annotation(Features)
Ubiquitination siteK345;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1345/636ALGAGVKKRRHGD Experimental21906983
Protein squence
Length636
Sequence
MAQSTATSPDGGTTFEHLWSSLEPDSTYFDLPQSSRGNNEVVGGTDSSMDVFHLEGMTTS
VMAQFNLLSSTMDQMSSRAASASPYTPEHAASVPTHSPYAQPSSTFDTMSPAPVIPSNTD
YPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTPPPPGTAIRAMPV
YKKAEHVTDVVKRCPNHELGRDFNEGQSAPASHLIRVEGNNLSQYVDDPVTGRQSVVVPY
EPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLEMRDGQVLGRRSFEGRICACPGR
DRKADEDHYREQQALNESSAKNGAASKRAFKQSPPAVPALGAGVKKRRHGDEDTYYLQVR
GRENFEILMKLKESLELMELVPQPLVDSYRQQQQLLQRPSHLQPPSYGPVLSPMNKVHGG
MNKLPSVNQLVGQPPPHSSAATPNLGPVGPGMLNNHGHAVPANGEMSSSHSAQSMVSGSH
CTPPPPYHADPSLVSFLTGLGCPNCIEYFTSQGLQSIYHLQNLTIEDLGALKIPEQYRMT
IWRGLQDLKQGHDYSTAQQLLRSSNAATISIGGSGELQRQRVMEAVHFRVRHTITIPNRG
GPGGGPDEWADFGFDLPDCKARKQPIKEEFTEAEIH
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn