Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberF4YUA0
OrganismHomo sapiens (Human)
Protein namesMHC class I antigen (Fragment)
Gene namesHLA-B
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Cellular component
Molecular function
Ubiquitination annotation(Features)
Ubiquitination siteK137; K145; K120;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1120/181QFAYDGKDYIALN Experimental21906983
No.2137/181SWTAADKAAQITQ Experimental21906983
No.3145/181AQITQRKWEAARE Experimental21906983
Protein squence
Length181
Sequence
SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGEPRAPWVEQEGPEYWD
RETQKYKRQAQTDRVNLRKLRGYYNQSEAGSHTLQRMYGCDLGPDGRLLRGYNQFAYDGK
DYIALNEDLRSWTAADKAAQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKKTLQR
A
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn