Mammalian Ubiquitination Site Database
Detail Information

 
General information
Uniprot Accession NumberC9JMN4
OrganismHomo sapiens (Human)
Protein names16 kDa protein
Gene namesFAM3C
Gene Ontology (GO) annotation
Gene Ontology (GO)
Biological process
Cellular component
Molecular function
Ubiquitination annotation(Features)
Ubiquitination siteK112;
Ubiquitination sequence
position/full lengthUbiquitination sequenceGraphical viewEvidencePubMed
No.1112/151VALANGKTGEVLD Experimental21906983
Protein squence
Length151
Sequence
MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGI
SKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTK
YFDMWGGDVAPFIEFLKAIQDGTIVLMGTYD
Half-life prediction
SProtP Human



Multi-species alignment analysis
Multi-species Alignment Analysis for Homo sapiens


Reference
Content
  1. PubMed:   21906983
    Woong Kim,Eric J. Bennett, Edward L. Huttlin, Ailan Guo, Jing Li, Anthony Possemato, Mathew E. Sowa,Ramin Rad, John Rush, Michael J. Comb, J. Wade Harper, and Steven P. Gygi.Systematic and Quantitative Assessment of the Ubiquitin-Modified Proteome. Molecular Cell.,2011,44:325-340.
 

We strongly recommend using Internet Explorer 8.0 (or higher version) for better compatibility.
Email : xfsong@nuaa.edu.cn
guo_xuejiang@njmu.edu.cn